PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sphfalx0103s0005.3.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Sphagnophytina; Sphagnopsida; Sphagnales; Sphagnaceae; Sphagnum
Family HB-other
Protein Properties Length: 240aa    MW: 26589.5 Da    PI: 4.9986
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sphfalx0103s0005.3.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox51.91.3e-162073457
                          -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
              Homeobox  4 RttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57
                          +++ +++q+e Le+ ++  +yps e r+eL kk+gL+ +q +vWF  rR k+++
  Sphfalx0103s0005.3.p 20 KWKKSPSQVELLEKIYADAKYPSDEVRAELGKKTGLSAKQLQVWFTHRRHKDRR 73
                          7999************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.9E-16574IPR009057Homeodomain-like
SuperFamilySSF466896.84E-15674IPR009057Homeodomain-like
PROSITE profilePS5007115.2081474IPR001356Homeobox domain
SMARTSM003891.2E-141678IPR001356Homeobox domain
CDDcd000867.28E-152074No hitNo description
PfamPF000463.8E-142073IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 240 aa     Download sequence    Send to blast
MACDDSTPVN SPEKQNSNYK WKKSPSQVEL LEKIYADAKY PSDEVRAELG KKTGLSAKQL  60
QVWFTHRRHK DRREGIDDDQ LTQPANCNNF DIDRHGLPST KRGEIDLNSR EDNKSEDGYP  120
AAVLAEEQDD DVLMAKEVNG TNVGDSDYEE IEKPKATTKR KSVPSSKEPR KPPCKSSSPK  180
SKLTSKAETV ELAAVRAVES QLNGPMREDG PPLGFEFDSP PPGAFEFMST EGMTMGLRV*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
16673RRHKDRRE
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_001767051.16e-44predicted protein
TrEMBLA9SKU07e-44A9SKU0_PHYPA; Predicted protein
STRINGPP1S89_188V6.14e-50(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28420.14e-23homeobox-1